Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor alpha variable 8-3 (TVA83)

This Recombinant Human T cell receptor alpha variable 8-3 (TVA83) spans the amino acid sequence from region 21-113. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor alpha variable 8-3 TRAV8-3

UniProt

A0A0A6YYJ7

Expression Region

21-113

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QSVTQPDIHITVSEGASLELRCNYSYGATPYLFWYVQSPGQGLQLLLKYFSGDTLVQGIKGFEAEFKRSQSSFNLRKPSVHWSDAAEYFCAVG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

C Reactive Protein (CRP) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI7C10]
TA807731AM 100 µL

C Reactive Protein (CRP) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI7C10]

Sign In for Pricing
View Details
1-(3,4-Dibenzyloxyphenyl)-2-nitropropene
TRC-D422690-50MG 50 mg

1-(3,4-Dibenzyloxyphenyl)-2-nitropropene

Sign In for Pricing
View Details
Tissue FFPE Sections, Endometrium
CS803362 5x 5 µm

Tissue FFPE Sections, Endometrium

Sign In for Pricing
View Details
Quinolinimide
TRC-Q711500-2G 2 g

Quinolinimide

Sign In for Pricing
View Details
FHL2 (NM_001450) Human Over-expression Lysate
LY419930 100 µg

FHL2 (NM_001450) Human Over-expression Lysate

Sign In for Pricing
View Details
Dolutegravir intermediate-1
TRC-D528812-250MG 250 mg

Dolutegravir intermediate-1

Sign In for Pricing
View Details