Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor alpha variable 8-3 (TVA83)

This Recombinant Human T cell receptor alpha variable 8-3 (TVA83) spans the amino acid sequence from region 21-113. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor alpha variable 8-3 TRAV8-3

UniProt

A0A0A6YYJ7

Expression Region

21-113

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QSVTQPDIHITVSEGASLELRCNYSYGATPYLFWYVQSPGQGLQLLLKYFSGDTLVQGIKGFEAEFKRSQSSFNLRKPSVHWSDAAEYFCAVG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ZNF175 Mouse Monoclonal Antibody [Clone ID: OTI1F2]
CF810669 100 µg

ZNF175 Mouse Monoclonal Antibody [Clone ID: OTI1F2]

Sign In for Pricing
View Details
Human LOC105372977 activation kit by CRISPRa
GA119679 1 Kit

Human LOC105372977 activation kit by CRISPRa

Sign In for Pricing
View Details
Frozen Tissue Sections, Thyroid gland
CS620962 5x 5 µm

Frozen Tissue Sections, Thyroid gland

Sign In for Pricing
View Details
Benzonitrile
TRC-B204600-5G 5 g

Benzonitrile

Sign In for Pricing
View Details
CD79b (B-Cell Marker) (IGB/1842), CF647 conjugate, 0.1mg/mL
BNC471842-500 1x 500 µL

CD79b (B-Cell Marker) (IGB/1842), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
ZNF664-RFLNA Rabbit Polyclonal Antibody
TA369585 100 µL

ZNF664-RFLNA Rabbit Polyclonal Antibody

Sign In for Pricing
View Details