Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor alpha variable 8-1 (TVA81)

This Recombinant Human T cell receptor alpha variable 8-1 (TVA81) spans the amino acid sequence from region 21-113. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor alpha variable 8-1 TRAV8-1

UniProt

A0A0A6YYK1

Expression Region

21-113

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QSVSQHNHHVILSEAASLELGCNYSYGGTVNLFWYVQYPGQHLQLLLKYFSGDPLVKGIKGFEAEFIKSKFSFNLRKPSVQWSDTAEYFCAVN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LIF Antibody
orb522658-01 50 μL

LIF Antibody

Sign In for Pricing
View Details
LIF Antibody
orb522658-02 100 µL

LIF Antibody

Sign In for Pricing
View Details
MBTD1 Adenovirus (Human)
28189051 1.0 mL

MBTD1 Adenovirus (Human)

Sign In for Pricing
View Details
NDC80 3'UTR Lenti-reporter-Luc Vector
31590081 1.0 µg

NDC80 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details
POLR3K protein (His tag)
80R-3892 0.02 mg

POLR3K protein (His tag)

Sign In for Pricing
View Details
BNIP3L Rabbit Polyclonal Antibody
TA374045 100 µL

BNIP3L Rabbit Polyclonal Antibody

Sign In for Pricing
View Details