Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor alpha variable 19 (TVA19)

This Recombinant Human T cell receptor alpha variable 19 (TVA19) spans the amino acid sequence from region 22-116. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor alpha variable 19; T-cell receptor alpha chain V region HPB-MLT; TRAV19

UniProt

A0A0A6YYK7

Expression Region

22-116

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QKVTQAQTEISVVEKEDVTLDCVYETRDTTYYLFWYKQPPSGELVFLIRRNSFDEQNEISGRYSWNFQKSTSSFNFTITASQVVDSAVYFCALSE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal Siglec-9 Antibody (MM0552-6K12) [Biotin]
NBP2-11905B 0.1 mL

Mouse Monoclonal Siglec-9 Antibody (MM0552-6K12) [Biotin]

Sign In for Pricing
View Details
NAA-004
MBS5811837 Inquire

NAA-004

Sign In for Pricing
View Details
Samd3 (NM_001013766) Mouse Tagged Lenti ORF Clone
MR217743L3 10 µg

Samd3 (NM_001013766) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details
ELOVL4 Double Nickase Plasmid (h2)
sc-407562-NIC-2 20 µg

ELOVL4 Double Nickase Plasmid (h2)

Sign In for Pricing
View Details
Heme oxygenase 2/HMOX2 Rabbit Polyclonal Antibody (Fluoro550)
orb3078423 100 µg

Heme oxygenase 2/HMOX2 Rabbit Polyclonal Antibody (Fluoro550)

Sign In for Pricing
View Details
GSTE93 Antibody
E93904 100 µg

GSTE93 Antibody

Sign In for Pricing
View Details