Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor alpha variable 19 (TVA19)

This Recombinant Human T cell receptor alpha variable 19 (TVA19) spans the amino acid sequence from region 22-116. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor alpha variable 19; T-cell receptor alpha chain V region HPB-MLT; TRAV19

UniProt

A0A0A6YYK7

Expression Region

22-116

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QKVTQAQTEISVVEKEDVTLDCVYETRDTTYYLFWYKQPPSGELVFLIRRNSFDEQNEISGRYSWNFQKSTSSFNFTITASQVVDSAVYFCALSE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

γS-crystallin (A-3) HRP
sc-374265 HRP 200 µg/mL

γS-crystallin (A-3) HRP

Sign In for Pricing
View Details
SPECC1L sgRNA CRISPR Lentivector set (Human)
K2805801 3x 1.0 µg

SPECC1L sgRNA CRISPR Lentivector set (Human)

Sign In for Pricing
View Details
ABL1 (Phospho-Thr735) Antibody
E11-8074A 100 µg

ABL1 (Phospho-Thr735) Antibody

Sign In for Pricing
View Details
IKBKG Protein Vector (Mouse) (pPM-C-HA)
PV191140 500 ng

IKBKG Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details
Aym1 (NM_001012726) Mouse Tagged ORF Clone Lentiviral Particle
MR212378L3V 200 µL

Aym1 (NM_001012726) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
LOC126537 Human shRNA Plasmid Kit (Locus ID 126537)
TL317832 1 Kit

LOC126537 Human shRNA Plasmid Kit (Locus ID 126537)

Sign In for Pricing
View Details