Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin lambda variable 1-36 (LV136)

This Recombinant Human Immunoglobulin lambda variable 1-36 (LV136) spans the amino acid sequence from region 20-117. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin lambda variable 1-36 IGLV1-36

UniProt

A0A0B4J1U3

Expression Region

20-117

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QSVLTQPPSVSEAPRQRVTISCSGSSSNIGNNAVNWYQQLPGKAPKLLIYYDDLLPSGVSDRFSGSKSGTSASLAISGLQSEDEADYYCAAWDDSLNG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-Integrin alpha 5 ITGA5 Rabbit Monoclonal Antibody, Carrier-free
M01911-carrier-free 100 µL

Anti-Integrin alpha 5 ITGA5 Rabbit Monoclonal Antibody, Carrier-free

Sign In for Pricing
View Details
Adrenomedullin (ADM) BioAssayTM ELISA Kit (Canine)
023177 96 Tests

Adrenomedullin (ADM) BioAssayTM ELISA Kit (Canine)

Sign In for Pricing
View Details
Recombinant Pisum sativum Probable aquaporin PIP-type 7a (TRG-31)
orb2910793-01 20 µg

Recombinant Pisum sativum Probable aquaporin PIP-type 7a (TRG-31)

Sign In for Pricing
View Details
Recombinant Pisum sativum Probable aquaporin PIP-type 7a (TRG-31)
orb2910793-02 100 µg

Recombinant Pisum sativum Probable aquaporin PIP-type 7a (TRG-31)

Sign In for Pricing
View Details
Anti-Calpain 2/CAPN2 Antibody Picoband®
A03492 100 µg/Vial

Anti-Calpain 2/CAPN2 Antibody Picoband®

Sign In for Pricing
View Details
Anti-PPX Antibody
MBS8324113-01 0.03 mL

Anti-PPX Antibody

Sign In for Pricing
View Details