Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin lambda variable 1-36 (LV136)

This Recombinant Human Immunoglobulin lambda variable 1-36 (LV136) spans the amino acid sequence from region 20-117. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin lambda variable 1-36 IGLV1-36

UniProt

A0A0B4J1U3

Expression Region

20-117

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QSVLTQPPSVSEAPRQRVTISCSGSSSNIGNNAVNWYQQLPGKAPKLLIYYDDLLPSGVSDRFSGSKSGTSASLAISGLQSEDEADYYCAAWDDSLNG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Spindlin 1 Rabbit Polyclonal Antibody (APC)
orb995297 100 µL

Spindlin 1 Rabbit Polyclonal Antibody (APC)

Sign In for Pricing
View Details
5-O-Caffeoylshikimic acid
MBS3614358-01 5 mg

5-O-Caffeoylshikimic acid

Sign In for Pricing
View Details
5-O-Caffeoylshikimic acid
MBS3614358-02 10 mg

5-O-Caffeoylshikimic acid

Sign In for Pricing
View Details
5-O-Caffeoylshikimic acid
MBS3614358-03 25 mg

5-O-Caffeoylshikimic acid

Sign In for Pricing
View Details
5-O-Caffeoylshikimic acid
MBS3614358-04 50 mg

5-O-Caffeoylshikimic acid

Sign In for Pricing
View Details
5-O-Caffeoylshikimic acid
MBS3614358-05 5x 50 mg

5-O-Caffeoylshikimic acid

Sign In for Pricing
View Details