Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin lambda variable 1-36 (LV136)

This Recombinant Human Immunoglobulin lambda variable 1-36 (LV136) spans the amino acid sequence from region 20-117. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin lambda variable 1-36 IGLV1-36

UniProt

A0A0B4J1U3

Expression Region

20-117

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QSVLTQPPSVSEAPRQRVTISCSGSSSNIGNNAVNWYQQLPGKAPKLLIYYDDLLPSGVSDRFSGSKSGTSASLAISGLQSEDEADYYCAAWDDSLNG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CRCP Human Pre-designed siRNA Set A
HY-RS03144 1 Set

CRCP Human Pre-designed siRNA Set A

Sign In for Pricing
View Details
LHX1 Polyclonal Antibody
orb617211-01 50 μL

LHX1 Polyclonal Antibody

Sign In for Pricing
View Details
LHX1 Polyclonal Antibody
orb617211-02 100 µL

LHX1 Polyclonal Antibody

Sign In for Pricing
View Details
CLSTN1 Antibody
orb619920 100 µL

CLSTN1 Antibody

Sign In for Pricing
View Details
Human PITHD1/PITH domain-containing protein 1 ELISA Kit
MBS2903829-01 48 Well

Human PITHD1/PITH domain-containing protein 1 ELISA Kit

Sign In for Pricing
View Details
Human PITHD1/PITH domain-containing protein 1 ELISA Kit
MBS2903829-02 96 Well

Human PITHD1/PITH domain-containing protein 1 ELISA Kit

Sign In for Pricing
View Details