Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor gamma variable 5 (TRGV5)

This Recombinant Human T cell receptor gamma variable 5 (TRGV5) spans the amino acid sequence from region 18-118. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor gamma variable 5 TRGV5 TCRGV5

UniProt

A0A0B4J1U4

Expression Region

18-118

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

KSSNLEGGTKSVTRPTRSSAEITCDLTVINAFYIHWYLHQEGKAPQRLLYYDVSNSKDVLESGLSPGKYYTHTPRRWSWILILRNLIENDSGVYYCATWDR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue FFPE Sections, Colon
CS809462 5x 5 µm

Tissue FFPE Sections, Colon

Sign In for Pricing
View Details
MMP3 Polyclonal Antibody
E-AB-60248-01 60 µL

MMP3 Polyclonal Antibody

Sign In for Pricing
View Details
MMP3 Polyclonal Antibody
E-AB-60248-02 120 µL

MMP3 Polyclonal Antibody

Sign In for Pricing
View Details
MMP3 Polyclonal Antibody
E-AB-60248-03 200 µL

MMP3 Polyclonal Antibody

Sign In for Pricing
View Details
Zfp553 Mouse Gene Knockout Kit (CRISPR)
KN519878 1 Kit

Zfp553 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Sos1 Mouse Gene Knockout Kit (CRISPR)
KN516478 1 Kit

Sos1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details