Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor gamma variable 5 (TRGV5)

This Recombinant Human T cell receptor gamma variable 5 (TRGV5) spans the amino acid sequence from region 18-118. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor gamma variable 5 TRGV5 TCRGV5

UniProt

A0A0B4J1U4

Expression Region

18-118

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

KSSNLEGGTKSVTRPTRSSAEITCDLTVINAFYIHWYLHQEGKAPQRLLYYDVSNSKDVLESGLSPGKYYTHTPRRWSWILILRNLIENDSGVYYCATWDR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Amplite® Fluorimetric Monoamine Oxidase Assay Kit *Red Fluorescence*
11303-AAT 200 Tests

Amplite® Fluorimetric Monoamine Oxidase Assay Kit *Red Fluorescence*

Sign In for Pricing
View Details
DDX39 (DDX39A) Human Gene Knockout Kit (CRISPR)
KN201759RB 1 Kit

DDX39 (DDX39A) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
MART-1 / Melan-A (M2-7C10 + M2-9E3), Biotin conjugate, 0.1mg/mL
BNCB0705-500 1x 500 µL

MART-1 / Melan-A (M2-7C10 + M2-9E3), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
HSP60 (HSPD1/780), CF568 conjugate, 0.1mg/mL
BNC680780-100 1x 100 µL

HSP60 (HSPD1/780), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Biotin PEG2 succinimidyl ester
3016-AAT 25 mg

Biotin PEG2 succinimidyl ester

Sign In for Pricing
View Details
4-Hydroxy Xylazine
TRC-H996300-1MG 1 mg

4-Hydroxy Xylazine

Sign In for Pricing
View Details