Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin heavy variable 6-1 (HV601)

This Recombinant Human Immunoglobulin heavy variable 6-1 (HV601) spans the amino acid sequence from region 21-121. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin heavy variable 6-1 IGHV6-1

UniProt

A0A0B4J1U7

Expression Region

21-121

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QVQLQQSGPGLVKPSQTLSLTCAISGDSVSSNSAAWNWIRQSPSRGLEWLGRTYYRSKWYNDYAVSVKSRITINPDTSKNQFSLQLNSVTPEDTAVYYCAR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Yipf7 Mouse Gene Knockout Kit (CRISPR)
KN519555 1 Kit

Yipf7 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
RFX1 (NM_002918) Human Recombinant Protein
TP307872L 1 mg

RFX1 (NM_002918) Human Recombinant Protein

Sign In for Pricing
View Details
ATP5F1B Rabbit Polyclonal Antibody
TA383784 100 µL

ATP5F1B Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
CMV-p65 (CMV100), 0.2mg/mL
BNUB0100-500 1x 500 µL

CMV-p65 (CMV100), 0.2mg/mL

Sign In for Pricing
View Details
SCARB1 Polyclonal Antibody
E-AB-10361-01 20 µL

SCARB1 Polyclonal Antibody

Sign In for Pricing
View Details
SCARB1 Polyclonal Antibody
E-AB-10361-02 60 µL

SCARB1 Polyclonal Antibody

Sign In for Pricing
View Details