Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin heavy variable 3-15 (HV315)

This Recombinant Human Immunoglobulin heavy variable 3-15 (HV315) spans the amino acid sequence from region 20-119. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin heavy variable 3-15 IGHV3-15

UniProt

A0A0B4J1V0

Expression Region

20-119

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

EVQLVESGGGLVKPGGSLRLSCAASGFTFSNAWMSWVRQAPGKGLEWVGRIKSKTDGGTTDYAAPVKGRFTISRDDSKNTLYLQMNSLKTEDTAVYYCTT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PAPSS2 Rabbit Polyclonal Antibody (HRP)
orb481447 100 µL

PAPSS2 Rabbit Polyclonal Antibody (HRP)

Sign In for Pricing
View Details
PSEN1 Antibody
GWB-MV443B 50 µg

PSEN1 Antibody

Sign In for Pricing
View Details
Cat Interleukin 10 Receptor Alpha ELISA Kit
MBS105745 Inquire

Cat Interleukin 10 Receptor Alpha ELISA Kit

Sign In for Pricing
View Details
RGS4 Rabbit Polyclonal Antibody (BF555)
orb2376241 100 µL

RGS4 Rabbit Polyclonal Antibody (BF555)

Sign In for Pricing
View Details
Pridopidine
orb1299893-01 5 mg

Pridopidine

Sign In for Pricing
View Details
Pridopidine
orb1299893-02 25 mg

Pridopidine

Sign In for Pricing
View Details