Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin heavy variable 2-26 (HV226)

This Recombinant Human Immunoglobulin heavy variable 2-26 (HV226) spans the amino acid sequence from region 20-119. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin heavy variable 2-26 IGHV2-26

UniProt

A0A0B4J1V2

Expression Region

20-119

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QVTLKESGPVLVKPTETLTLTCTVSGFSLSNARMGVSWIRQPPGKALEWLAHIFSNDEKSYSTSLKSRLTISKDTSKSQVVLTMTNMDPVDTATYYCARI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-GIT2 Rabbit pAb
GB111092-100 100 μL

Anti-GIT2 Rabbit pAb

Sign In for Pricing
View Details
N-[ (4-Fluorophenyl) methyl]-4-phenyl-1,3-thiazol-2-amine
ZDB41430-01 250 mg

N-[ (4-Fluorophenyl) methyl]-4-phenyl-1,3-thiazol-2-amine

Sign In for Pricing
View Details
N-[ (4-Fluorophenyl) methyl]-4-phenyl-1,3-thiazol-2-amine
ZDB41430-02 2.5 g

N-[ (4-Fluorophenyl) methyl]-4-phenyl-1,3-thiazol-2-amine

Sign In for Pricing
View Details
ST2 CRISPR Knock Out 293T Cell Line (Human)
45626141 1x 10^6 Cells / 1.0 mL

ST2 CRISPR Knock Out 293T Cell Line (Human)

Sign In for Pricing
View Details
(4-bromophenyl) (4- (trifluoromethyl) phenyl) methanol
PC1021839-01 250 mg

(4-bromophenyl) (4- (trifluoromethyl) phenyl) methanol

Sign In for Pricing
View Details
(4-bromophenyl) (4- (trifluoromethyl) phenyl) methanol
PC1021839-02 500 mg

(4-bromophenyl) (4- (trifluoromethyl) phenyl) methanol

Sign In for Pricing
View Details