Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin lambda variable 9-49 (LV949)

This Recombinant Human Immunoglobulin lambda variable 9-49 (LV949) spans the amino acid sequence from region 20-123. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin lambda variable 9-49 IGLV9-49

UniProt

A0A0B4J1Y8

Expression Region

20-123

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QPVLTQPPSASASLGASVTLTCTLSSGYSNYKVDWYQQRPGKGPRFVMRVGTGGIVGSKGDGIPDRFSVLGSGLNRYLTIKNIQEEDESDYHCGADHGSGSNFV

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Monocarboxylate transporter 1 ELISA Kit
orb1658670 96 Tests

Rat Monocarboxylate transporter 1 ELISA Kit

Sign In for Pricing
View Details
Insulin Like Growth Factor Binding Protein 3 (IGFBP3) BioAssayTM ELISA Kit (Rat)
025875 96 Tests

Insulin Like Growth Factor Binding Protein 3 (IGFBP3) BioAssayTM ELISA Kit (Rat)

Sign In for Pricing
View Details
Mycophenolate mofetil
BML-IM101-0100 100 mg

Mycophenolate mofetil

Sign In for Pricing
View Details
PDPN (Aggrus, Glycoprotein 36)
145044 100 µg

PDPN (Aggrus, Glycoprotein 36)

Sign In for Pricing
View Details
[pGlu3]-TLQP-21 (3-21) amide (Human)
007-83 100 µg

[pGlu3]-TLQP-21 (3-21) amide (Human)

Sign In for Pricing
View Details
RPAP3 Protein Vector (Human) (pPM-C-His)
PV035732 500 ng

RPAP3 Protein Vector (Human) (pPM-C-His)

Sign In for Pricing
View Details