Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin lambda variable 9-49 (LV949)

This Recombinant Human Immunoglobulin lambda variable 9-49 (LV949) spans the amino acid sequence from region 20-123. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin lambda variable 9-49 IGLV9-49

UniProt

A0A0B4J1Y8

Expression Region

20-123

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QPVLTQPPSASASLGASVTLTCTLSSGYSNYKVDWYQQRPGKGPRFVMRVGTGGIVGSKGDGIPDRFSVLGSGLNRYLTIKNIQEEDESDYHCGADHGSGSNFV

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-JUNB Antibody Picoband®, Cy3 Conjugate
A01825-2-Cy3 100 µg/Vial

Anti-JUNB Antibody Picoband®, Cy3 Conjugate

Sign In for Pricing
View Details
Rabbit Polyclonal Ephrin-B2 Antibody [DyLight 680]
NBP2-99653FR 0.1 mL

Rabbit Polyclonal Ephrin-B2 Antibody [DyLight 680]

Sign In for Pricing
View Details
DUOX2 Antibody
E047081 100 µg -100 µL

DUOX2 Antibody

Sign In for Pricing
View Details
1700013G24Rik sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 2)
K3132507 1.0 µg DNA

1700013G24Rik sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 2)

Sign In for Pricing
View Details
Tmem138 Mouse Gene Knockout Kit (CRISPR)
KN517725 1 Kit

Tmem138 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
GREM1 (Gremlin 1, Cysteine Knot Superfamily, Homolog (Xenopus laevis), CKTSF1B1, DAND2, DRM, Gremlin, IHG-2, MGC126660, PIG2) (Biotin)
246759-Biotin 100 µL

GREM1 (Gremlin 1, Cysteine Knot Superfamily, Homolog (Xenopus laevis), CKTSF1B1, DAND2, DRM, Gremlin, IHG-2, MGC126660, PIG2) (Biotin)

Sign In for Pricing
View Details