Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin lambda variable 9-49 (LV949)

This Recombinant Human Immunoglobulin lambda variable 9-49 (LV949) spans the amino acid sequence from region 20-123. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin lambda variable 9-49 IGLV9-49

UniProt

A0A0B4J1Y8

Expression Region

20-123

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QPVLTQPPSASASLGASVTLTCTLSSGYSNYKVDWYQQRPGKGPRFVMRVGTGGIVGSKGDGIPDRFSVLGSGLNRYLTIKNIQEEDESDYHCGADHGSGSNFV

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

TAFA3 (NM_182759) Human Over-expression Lysate
LS284467-20ug 20 µg

TAFA3 (NM_182759) Human Over-expression Lysate

Sign In for Pricing
View Details
10X TBS Fish Gel Concentrate
OORA00251-1EA 10x 100 mL

10X TBS Fish Gel Concentrate

Sign In for Pricing
View Details
Alpha-tubulin Antibody
7175-01mg 0.1 mg

Alpha-tubulin Antibody

Sign In for Pricing
View Details
Rabbit Cyclooxygenase 2 (COX-2) ELISA Kit
YP-W73774-01 48 Tests

Rabbit Cyclooxygenase 2 (COX-2) ELISA Kit

Sign In for Pricing
View Details
Rabbit Cyclooxygenase 2 (COX-2) ELISA Kit
YP-W73774-02 96 Tests

Rabbit Cyclooxygenase 2 (COX-2) ELISA Kit

Sign In for Pricing
View Details
RAB27B (Ras-related Protein Rab-27B, C25KG) (PE)
MBS6391714-01 0.1 mL

RAB27B (Ras-related Protein Rab-27B, C25KG) (PE)

Sign In for Pricing
View Details