Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin heavy variable 3-72 (HV372)

This Recombinant Human Immunoglobulin heavy variable 3-72 (HV372) spans the amino acid sequence from region 20-119. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin heavy variable 3-72 IGHV3-72

UniProt

A0A0B4J1Y9

Expression Region

20-119

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

EVQLVESGGGLVQPGGSLRLSCAASGFTFSDHYMDWVRQAPGKGLEWVGRTRNKANSYTTEYAASVKGRFTISRDDSKNSLYLQMNSLKTEDTAVYYCAR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

17,17-(Ethylenedioxy)androst-4-en-3Beta-ol
TRC-E979660-50MG 50 mg

17,17-(Ethylenedioxy)androst-4-en-3Beta-ol

Sign In for Pricing
View Details
Raclopride
TRC-R708030-25MG 25 mg

Raclopride

Sign In for Pricing
View Details
CNGA4 (NM_001037329) Human Over-expression Lysate
LY421949 100 µg

CNGA4 (NM_001037329) Human Over-expression Lysate

Sign In for Pricing
View Details
Ctsb Mouse Gene Knockout Kit (CRISPR)
KN303984RB 1 Kit

Ctsb Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Involucrin (Squamous Cell Terminal Differentiation Marker) (rIVRN/827), CF405S conjugate, 0.1mg/mL
BNC043640-500 1x 500 µL

Involucrin (Squamous Cell Terminal Differentiation Marker) (rIVRN/827), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
FITC Anti-Human CD5 Antibody[HISM2]
E-AB-F1313C-01 20 Tests

FITC Anti-Human CD5 Antibody[HISM2]

Sign In for Pricing
View Details