Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin heavy variable 3-72 (HV372)

This Recombinant Human Immunoglobulin heavy variable 3-72 (HV372) spans the amino acid sequence from region 20-119. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin heavy variable 3-72 IGHV3-72

UniProt

A0A0B4J1Y9

Expression Region

20-119

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

EVQLVESGGGLVQPGGSLRLSCAASGFTFSDHYMDWVRQAPGKGLEWVGRTRNKANSYTTEYAASVKGRFTISRDDSKNSLYLQMNSLKTEDTAVYYCAR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-Mouse Ly49C (4LO3311) In Vivo Antibody - Low Endotoxin
ICH1202-25mg 25 mg

Anti-Mouse Ly49C (4LO3311) In Vivo Antibody - Low Endotoxin

Sign In for Pricing
View Details
Eph receptor B2 Recombinant Rabbit monoclonal Antibody
HA723693 100 µL

Eph receptor B2 Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
Recombinant SARS-CoV-2 Spike RBD (F490L) (His Tag)
PKSV030468 100 µg

Recombinant SARS-CoV-2 Spike RBD (F490L) (His Tag)

Sign In for Pricing
View Details
Eosinophil Peroxidase (AHE-1), 0.2mg/mL
BNUB1231-100 1x 100 µL

Eosinophil Peroxidase (AHE-1), 0.2mg/mL

Sign In for Pricing
View Details
CHRNA6 Rabbit Polyclonal Antibody
TA367512 100 µL

CHRNA6 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
PSD93 (DLG2) Rabbit Polyclonal Antibody
TA371471 100 µL

PSD93 (DLG2) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details