Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin kappa variable 1D-43 (KVD43)

This Recombinant Human Immunoglobulin kappa variable 1D-43 (KVD43) spans the amino acid sequence from region 23-117. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin kappa variable 1D-43 IGKV1D-43

UniProt

A0A0B4J1Z2

Expression Region

23-117

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

AIRMTQSPFSLSASVGDRVTITCWASQGISSYLAWYQQKPAKAPKLFIYYASSLQSGVPSRFSGSGSGTDYTLTISSLQPEDFATYYCQQYYSTP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NUTF2 sgRNA CRISPR Lentivector (Human) (Target 2)
K1470303 1.0 µg DNA

NUTF2 sgRNA CRISPR Lentivector (Human) (Target 2)

Sign In for Pricing
View Details
(Tyr⁰) -C-Peptide (human)
4034546.0500 0.5 mg

(Tyr⁰) -C-Peptide (human)

Sign In for Pricing
View Details
CD43 (T Cell Marker, Leukosialin, Sialophorin, Leukocyte Sialoglycoprotein)
299339 100 µL

CD43 (T Cell Marker, Leukosialin, Sialophorin, Leukocyte Sialoglycoprotein)

Sign In for Pricing
View Details
Cardiotrophin-1 Polyclonal Antibody
MBS8521619-01 0.1 mg

Cardiotrophin-1 Polyclonal Antibody

Sign In for Pricing
View Details
Cardiotrophin-1 Polyclonal Antibody
MBS8521619-02 0.1 mL (AF635)

Cardiotrophin-1 Polyclonal Antibody

Sign In for Pricing
View Details
Cardiotrophin-1 Polyclonal Antibody
MBS8521619-03 0.1 mL (AF610)

Cardiotrophin-1 Polyclonal Antibody

Sign In for Pricing
View Details