Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin kappa variable 1D-43 (KVD43)

This Recombinant Human Immunoglobulin kappa variable 1D-43 (KVD43) spans the amino acid sequence from region 23-117. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin kappa variable 1D-43 IGKV1D-43

UniProt

A0A0B4J1Z2

Expression Region

23-117

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

AIRMTQSPFSLSASVGDRVTITCWASQGISSYLAWYQQKPAKAPKLFIYYASSLQSGVPSRFSGSGSGTDYTLTISSLQPEDFATYYCQQYYSTP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Guanosine-5'-monophosphate
sc-295032 1 g

Guanosine-5'-monophosphate

Sign In for Pricing
View Details
2,5,8,11,14,17,20,23,26,29,32,35,38,41,44,47-Hexadecaoxanonatetracontan-49-ol
sc-490021 100 mg

2,5,8,11,14,17,20,23,26,29,32,35,38,41,44,47-Hexadecaoxanonatetracontan-49-ol

Sign In for Pricing
View Details
PE-conjugated Anti-BAFF-R antibody (DM143); Rabbit mAb
MBS1882610-01 100 Tests

PE-conjugated Anti-BAFF-R antibody (DM143); Rabbit mAb

Sign In for Pricing
View Details
PE-conjugated Anti-BAFF-R antibody (DM143); Rabbit mAb
MBS1882610-02 5x 100 Tests

PE-conjugated Anti-BAFF-R antibody (DM143); Rabbit mAb

Sign In for Pricing
View Details
Lentiviral human GGT7 shRNA (UAS) - Lentiviral human GGT7 shRNA (UAS, GFP) plasmid
GTR15323173 1 Vial

Lentiviral human GGT7 shRNA (UAS) - Lentiviral human GGT7 shRNA (UAS, GFP) plasmid

Sign In for Pricing
View Details
IFluor® 800 Anti-human CD4 Antibody *RPA-T4*
100410N0-AAT 100 Tests

IFluor® 800 Anti-human CD4 Antibody *RPA-T4*

Sign In for Pricing
View Details