Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor alpha variable 2 (TVA2)

This Recombinant Human T cell receptor alpha variable 2 (TVA2) spans the amino acid sequence from region 26-112. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor alpha variable 2 TRAV2

UniProt

A0A0B4J234

Expression Region

26-112

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

KDQVFQPSTVASSEGAVVEIFCNHSVSNAYNFFWYLHFPGCAPRLLVKGSKPSQQGRYNMTYERFSSSLLILQVREADAAVYYCAVE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ADO (NM_032804) Human Recombinant Protein
TP305583 20 µg

ADO (NM_032804) Human Recombinant Protein

Sign In for Pricing
View Details
ARMC3 Human qPCR Primer Pair (NM_173081)
HP218274 200 Reactions

ARMC3 Human qPCR Primer Pair (NM_173081)

Sign In for Pricing
View Details
Phenoxy-d5-acetic Acid Ethyl Ester
TRC-P318152-10MG 10 mg

Phenoxy-d5-acetic Acid Ethyl Ester

Sign In for Pricing
View Details
Scd2 Mouse Gene Knockout Kit (CRISPR)
KN515349 1 Kit

Scd2 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
HSP27 (Ab-82) Antibody
8B7112-AAT 50 µg

HSP27 (Ab-82) Antibody

Sign In for Pricing
View Details
IL-4 (Interleukin-4), Mouse (11B11), CF740 conjugate, 0.1mg/mL
BNC742008-500 1x 500 µL

IL-4 (Interleukin-4), Mouse (11B11), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details