Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor alpha variable 2 (TVA2)

This Recombinant Human T cell receptor alpha variable 2 (TVA2) spans the amino acid sequence from region 26-112. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor alpha variable 2 TRAV2

UniProt

A0A0B4J234

Expression Region

26-112

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

KDQVFQPSTVASSEGAVVEIFCNHSVSNAYNFFWYLHFPGCAPRLLVKGSKPSQQGRYNMTYERFSSSLLILQVREADAAVYYCAVE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD24 Polyclonal Antibody, PE Conjugated
bs-4891R-PE-TR 20 µL

CD24 Polyclonal Antibody, PE Conjugated

Sign In for Pricing
View Details
Kinesis Adapter 5/16-24 Female to 1/2-20 Female PEEK
CHR5095 1 Each

Kinesis Adapter 5/16-24 Female to 1/2-20 Female PEEK

Sign In for Pricing
View Details
605nm Filter (range 590-607nm)
CS-F605-GX 1 Each

605nm Filter (range 590-607nm)

Sign In for Pricing
View Details
WIF1 (Wnt Inhibitory Factor 1, WIF-1, UNQ191/PRO217) (MaxLight 490)
MBS6398563-01 0.1 mL

WIF1 (Wnt Inhibitory Factor 1, WIF-1, UNQ191/PRO217) (MaxLight 490)

Sign In for Pricing
View Details
WIF1 (Wnt Inhibitory Factor 1, WIF-1, UNQ191/PRO217) (MaxLight 490)
MBS6398563-02 5x 0.1 mL

WIF1 (Wnt Inhibitory Factor 1, WIF-1, UNQ191/PRO217) (MaxLight 490)

Sign In for Pricing
View Details
NUDT5 rabbit pAb
UB-GEN-8222 100 µL

NUDT5 rabbit pAb

Sign In for Pricing
View Details