Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor alpha variable 13-2 (TVAM2)

This Recombinant Human T cell receptor alpha variable 13-2 (TVAM2) spans the amino acid sequence from region 22-113. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor alpha variable 13-2 TRAV13-2

UniProt

A0A0B4J235

Expression Region

22-113

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

ESVGLHLPTLSVQEGDNSIINCAYSNSASDYFIWYKQESGKGPQFIIDIRSNMDKRQGQRVTVLLNKTVKHLSLQIAATQPGDSAVYFCAEN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Nebramine Hydrochloride
TRC-N388255-1MG 1 mg

Nebramine Hydrochloride

Sign In for Pricing
View Details
2-Mercaptoethanol (poison pk)
EC-603 50 mL

2-Mercaptoethanol (poison pk)

Sign In for Pricing
View Details
D-Ribose 1-Phosphate, Biscyclohexylammonium Salt
TRC-R495000-1MG 1 mg

D-Ribose 1-Phosphate, Biscyclohexylammonium Salt

Sign In for Pricing
View Details
Recombinant Human VSIG4 Protein (Fc Tag)
PKSH030886 100 µg

Recombinant Human VSIG4 Protein (Fc Tag)

Sign In for Pricing
View Details
CD63 (Late Endosomes Marker) (LAMP3/2788), CF740 conjugate, 0.1mg/mL
BNC742788-100 1x 100 µL

CD63 (Late Endosomes Marker) (LAMP3/2788), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Hexadecanedioic Acid
TRC-H293633-50MG 50 mg

Hexadecanedioic Acid

Sign In for Pricing
View Details