Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor alpha variable 13-2 (TVAM2)

This Recombinant Human T cell receptor alpha variable 13-2 (TVAM2) spans the amino acid sequence from region 22-113. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor alpha variable 13-2 TRAV13-2

UniProt

A0A0B4J235

Expression Region

22-113

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

ESVGLHLPTLSVQEGDNSIINCAYSNSASDYFIWYKQESGKGPQFIIDIRSNMDKRQGQRVTVLLNKTVKHLSLQIAATQPGDSAVYFCAEN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Renin Receptor Double Nickase Plasmid (m)
sc-427726-NIC 20 µg

Renin Receptor Double Nickase Plasmid (m)

Sign In for Pricing
View Details
Cypt15 (NM_001177380) Mouse Tagged Lenti ORF Clone
MR219555L3 10 µg

Cypt15 (NM_001177380) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details
OKRC01390-96W - CD40 Ligand/TNFSF5 ELISA Kit (Rat)
OKRC01390-96W 96 Well

OKRC01390-96W - CD40 Ligand/TNFSF5 ELISA Kit (Rat)

Sign In for Pricing
View Details
CD99L2 AAV Vector (Human) (CMV)
15585102 1 µg

CD99L2 AAV Vector (Human) (CMV)

Sign In for Pricing
View Details
HRH4 Polyclonal Antibody, APC-Cy7 Conjugated
bs-10993R-APC-Cy7 100 µL

HRH4 Polyclonal Antibody, APC-Cy7 Conjugated

Sign In for Pricing
View Details
Anti-LCLAT1 Polyclonal Antibody
TMAB-01054-01 50 μL

Anti-LCLAT1 Polyclonal Antibody

Sign In for Pricing
View Details