Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor alpha variable 1-2 (TVA12)

This Recombinant Human T cell receptor alpha variable 1-2 (TVA12) spans the amino acid sequence from region 19-106. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor alpha variable 1-2 TRAV1-2

UniProt

A0A0B4J238

Expression Region

19-106

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QNIDQPTEMTATEGAIVQINCTYQTSGFNGLFWYQQHAGEAPTFLSYNVLDGLEEKGRFSSFLSRSKGYSYLLLKELQMKDSASYLCA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Anti-GDF8 antibody
SL23012R-01 50 µL

Rabbit Anti-GDF8 antibody

Sign In for Pricing
View Details
Rabbit Anti-GDF8 antibody
SL23012R-02 100 µL

Rabbit Anti-GDF8 antibody

Sign In for Pricing
View Details
Recombinant Human Synaptosomal-associated protein 23kDa
32-4872-25 25 µg

Recombinant Human Synaptosomal-associated protein 23kDa

Sign In for Pricing
View Details
MRGX3 Polyclonal Antibody
RA27373-01 50 µL

MRGX3 Polyclonal Antibody

Sign In for Pricing
View Details
MRGX3 Polyclonal Antibody
RA27373-02 100 µL

MRGX3 Polyclonal Antibody

Sign In for Pricing
View Details
Zfp709 siRNA Oligos set (Mouse)
51097174 3x 5 nmol

Zfp709 siRNA Oligos set (Mouse)

Sign In for Pricing
View Details