Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor alpha variable 10 (TVA10)

This Recombinant Human T cell receptor alpha variable 10 (TVA10) spans the amino acid sequence from region 22-114. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor alpha variable 10 TRAV10

UniProt

A0A0B4J240

Expression Region

22-114

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

KNQVEQSPQSLIILEGKNCTLQCNYTVSPFSNLRWYKQDTGRGPVSLTIMTFSENTKSNGRYTATLDADTKQSSLHITASQLSDSASYICVVS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Keratin Type I Cytoskeletal 18 (KRT18) Mouse anti-Human Monoclonal (DA-7) Antibody
GWB-6CE9F2 0.05 mg

Keratin Type I Cytoskeletal 18 (KRT18) Mouse anti-Human Monoclonal (DA-7) Antibody

Sign In for Pricing
View Details
TTLL10 Human Over-expression Lysate
orb1340991 100 µg

TTLL10 Human Over-expression Lysate

Sign In for Pricing
View Details
Recombinant Macaca fascicularis B- and T-lymphocyte attenuator (BTLA), partial (Active)
orb2986590-01 20 µg

Recombinant Macaca fascicularis B- and T-lymphocyte attenuator (BTLA), partial (Active)

Sign In for Pricing
View Details
Recombinant Macaca fascicularis B- and T-lymphocyte attenuator (BTLA), partial (Active)
orb2986590-02 100 µg

Recombinant Macaca fascicularis B- and T-lymphocyte attenuator (BTLA), partial (Active)

Sign In for Pricing
View Details
Recombinant Macaca fascicularis B- and T-lymphocyte attenuator (BTLA), partial (Active)
orb2986590-03 1 mg

Recombinant Macaca fascicularis B- and T-lymphocyte attenuator (BTLA), partial (Active)

Sign In for Pricing
View Details
Human CellExp™ EPHB4, human recombinant
7451-20 20 µg

Human CellExp™ EPHB4, human recombinant

Sign In for Pricing
View Details