Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor alpha variable 10 (TVA10)

This Recombinant Human T cell receptor alpha variable 10 (TVA10) spans the amino acid sequence from region 22-114. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor alpha variable 10 TRAV10

UniProt

A0A0B4J240

Expression Region

22-114

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

KNQVEQSPQSLIILEGKNCTLQCNYTVSPFSNLRWYKQDTGRGPVSLTIMTFSENTKSNGRYTATLDADTKQSSLHITASQLSDSASYICVVS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Glutathione Synthetase (GSS) Antibody
abx455413-01 50 µg

Glutathione Synthetase (GSS) Antibody

Sign In for Pricing
View Details
Glutathione Synthetase (GSS) Antibody
abx455413-02 100 µg

Glutathione Synthetase (GSS) Antibody

Sign In for Pricing
View Details
HDAC3 Antibody - C-terminal region : HRP (ARP74556_P050-HRP)
ARP74556_P050-HRP 100 µL

HDAC3 Antibody - C-terminal region : HRP (ARP74556_P050-HRP)

Sign In for Pricing
View Details
WDR61 Antibody
MBS153510-01 0.1 mg

WDR61 Antibody

Sign In for Pricing
View Details
WDR61 Antibody
MBS153510-02 5x 0.1 mg

WDR61 Antibody

Sign In for Pricing
View Details
Olfr777 Double Nickase Plasmid (m2)
sc-434676-NIC-2 20 µg

Olfr777 Double Nickase Plasmid (m2)

Sign In for Pricing
View Details