Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor alpha variable 10 (TVA10)

This Recombinant Human T cell receptor alpha variable 10 (TVA10) spans the amino acid sequence from region 22-114. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor alpha variable 10 TRAV10

UniProt

A0A0B4J240

Expression Region

22-114

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

KNQVEQSPQSLIILEGKNCTLQCNYTVSPFSNLRWYKQDTGRGPVSLTIMTFSENTKSNGRYTATLDADTKQSSLHITASQLSDSASYICVVS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal CLP24/TMEM204 Antibody (652424) [DyLight 680]
FAB6747Y 0.1 mL

Mouse Monoclonal CLP24/TMEM204 Antibody (652424) [DyLight 680]

Sign In for Pricing
View Details
Guinea Pig Olfactory receptor 1B1 (OR1B1) ELISA kit
GTR10398550 96 Well

Guinea Pig Olfactory receptor 1B1 (OR1B1) ELISA kit

Sign In for Pricing
View Details
Pebp1 Rat siRNA Oligo Duplex (Locus ID 29542)
SR511385 1 Kit

Pebp1 Rat siRNA Oligo Duplex (Locus ID 29542)

Sign In for Pricing
View Details
Paraffin Tissue Section Panel - Mouse Normal Tissue, Multi-tissue III
T8334423 5 Slides

Paraffin Tissue Section Panel - Mouse Normal Tissue, Multi-tissue III

Sign In for Pricing
View Details
ERK1/2 Monoclonal Antibody, AbBy Fluor™ 680 Conjugated
bsm-33337M-BF680 100 µL

ERK1/2 Monoclonal Antibody, AbBy Fluor™ 680 Conjugated

Sign In for Pricing
View Details
PBS 1X, pH 7.4 solution
GB4757-500ml 500 mL

PBS 1X, pH 7.4 solution

Sign In for Pricing
View Details