Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor alpha variable 3 (TVA3)

This Recombinant Human T cell receptor alpha variable 3 (TVA3) spans the amino acid sequence from region 21-114. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor alpha variable 3 TRAV3

UniProt

A0A0B4J244

Expression Region

21-114

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QSVAQPEDQVNVAEGNPLTVKCTYSVSGNPYLFWYVQYPNRGLQFLLKYITGDNLVKGSYGFEAEFNKSQTSFHLKKPSALVSDSALYFCAVRD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NEUROD2 Antibody
MBS5314734-01 0.1 mL

NEUROD2 Antibody

Sign In for Pricing
View Details
NEUROD2 Antibody
MBS5314734-02 5x 0.1 mL

NEUROD2 Antibody

Sign In for Pricing
View Details
Mouse Anti-Ubiquitin Recombinant Antibody (EC262)
V2LY-0613-LY262 Each

Mouse Anti-Ubiquitin Recombinant Antibody (EC262)

Sign In for Pricing
View Details
Sheep anti-Human IgG3 Antibody (HRP)
abx401418 1 mL

Sheep anti-Human IgG3 Antibody (HRP)

Sign In for Pricing
View Details
TFEB Rabbit Polyclonal Antibody (FITC)
orb2084190 100 µL

TFEB Rabbit Polyclonal Antibody (FITC)

Sign In for Pricing
View Details
OXSR1 Rabbit pAb
E2822820 100 µL

OXSR1 Rabbit pAb

Sign In for Pricing
View Details