Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor alpha variable 3 (TVA3)

This Recombinant Human T cell receptor alpha variable 3 (TVA3) spans the amino acid sequence from region 21-114. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor alpha variable 3 TRAV3

UniProt

A0A0B4J244

Expression Region

21-114

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QSVAQPEDQVNVAEGNPLTVKCTYSVSGNPYLFWYVQYPNRGLQFLLKYITGDNLVKGSYGFEAEFNKSQTSFHLKKPSALVSDSALYFCAVRD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human Surfactant protein D/SP-D (C-His)
BP251-1mg 1 mg

Recombinant Human Surfactant protein D/SP-D (C-His)

Sign In for Pricing
View Details
Rabbit Anti CCND3 Polyclonal Affinity Purified (PBS with 0.02% sodium azide, 50% glycerol, pH7.3) (Western Blot) 200ul
IRBAMLCCND3AP262200UL 200 µL

Rabbit Anti CCND3 Polyclonal Affinity Purified (PBS with 0.02% sodium azide, 50% glycerol, pH7.3) (Western Blot) 200ul

Sign In for Pricing
View Details
FLJ20021 Human shRNA Lentiviral Particle (Locus ID 90024)
TL319705V 500 µL Each

FLJ20021 Human shRNA Lentiviral Particle (Locus ID 90024)

Sign In for Pricing
View Details
Tyk2-IN-5 100mg
A20268-100 100 mg

Tyk2-IN-5 100mg

Sign In for Pricing
View Details
Lentiviral human RASGRF1 shRNA (UAS) - Lentiviral human RASGRF1 shRNA (UAS, RFP) (100)
GTR15345171 1 Vial

Lentiviral human RASGRF1 shRNA (UAS) - Lentiviral human RASGRF1 shRNA (UAS, RFP) (100)

Sign In for Pricing
View Details
FITC Anti-Human CD15 Antibody
JOT21745F 20Tests

FITC Anti-Human CD15 Antibody

Sign In for Pricing
View Details