Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor alpha variable 12-1 (TVAL1)

This Recombinant Human T cell receptor alpha variable 12-1 (TVAL1) spans the amino acid sequence from region 21-112. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor alpha variable 12-1 TRAV12-1

UniProt

A0A0B4J245

Expression Region

21-112

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QRKEVEQDPGPFNVPEGATVAFNCTYSNSASQSFFWYRQDCRKEPKLLMSVYSSGNEDGRFTAQLNRASQYISLLIRDSKLSDSATYLCVVN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD130 Mouse Monoclonal Antibody [B11-B9-A8]
EM1701-43 100 µL

CD130 Mouse Monoclonal Antibody [B11-B9-A8]

Sign In for Pricing
View Details
Horseradish Peroxidase Conjugated Goat Affinity Purified Antibody to Equine IgG
HAF-431-1 1 mL

Horseradish Peroxidase Conjugated Goat Affinity Purified Antibody to Equine IgG

Sign In for Pricing
View Details
Decabromodiphenylethane
TRC-D212800-25G 25 g

Decabromodiphenylethane

Sign In for Pricing
View Details
Creatine Kinase-BB (CK-BB) (CKBB/1268), CF488A conjugate, 0.1mg/mL
BNC881268-500 1x 500 µL

Creatine Kinase-BB (CK-BB) (CKBB/1268), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CREB1 Human Gene Knockout Kit (CRISPR)
KN202115 1 Kit

CREB1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
LPPR4 (PLPPR4) Human Gene Knockout Kit (CRISPR)
KN420842 1 Kit

LPPR4 (PLPPR4) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details