Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor alpha variable 1-1 (TVA11)

This Recombinant Human T cell receptor alpha variable 1-1 (TVA11) spans the amino acid sequence from region 19-108. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor alpha variable 1-1 TRAV1-1

UniProt

A0A0B4J248

Expression Region

19-108

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QSLEQPSEVTAVEGAIVQINCTYQTSGFYGLSWYQQHDGGAPTFLSYNALDGLEETGRFSSFLSRSDSYGYLLLQELQMKDSASYFCAVR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MFluor™ Violet 510 Anti-human CD143 Antibody *5-369*
11430111-AAT 500 Tests

MFluor™ Violet 510 Anti-human CD143 Antibody *5-369*

Sign In for Pricing
View Details
ORF19 ORF Vector (Mouse) (pORF)
35737014 1.0 µg DNA

ORF19 ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details
ifnlr1 Antibody, Biotin Conjugated
MBS7134554-01 0.05 mL

ifnlr1 Antibody, Biotin Conjugated

Sign In for Pricing
View Details
ifnlr1 Antibody, Biotin Conjugated
MBS7134554-02 0.1 mL

ifnlr1 Antibody, Biotin Conjugated

Sign In for Pricing
View Details
ifnlr1 Antibody, Biotin Conjugated
MBS7134554-03 5x 0.1 mL

ifnlr1 Antibody, Biotin Conjugated

Sign In for Pricing
View Details
MIP3/CCL23 Recombinant Antibody, AbBy Fluor™ 750 Conjugated
bsm-61414R-BF750-01 20 µL

MIP3/CCL23 Recombinant Antibody, AbBy Fluor™ 750 Conjugated

Sign In for Pricing
View Details