Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor alpha variable 1-1 (TVA11)

This Recombinant Human T cell receptor alpha variable 1-1 (TVA11) spans the amino acid sequence from region 19-108. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor alpha variable 1-1 TRAV1-1

UniProt

A0A0B4J248

Expression Region

19-108

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QSLEQPSEVTAVEGAIVQINCTYQTSGFYGLSWYQQHDGGAPTFLSYNALDGLEETGRFSSFLSRSDSYGYLLLQELQMKDSASYFCAVR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MTERF AAV siRNA Pooled Vector
30875161 1.0 µg

MTERF AAV siRNA Pooled Vector

Sign In for Pricing
View Details
MTMR14, NT (MTMR14, C3orf29, Myotubularin-related protein 14, HCV NS5A-transactivated protein 4 splice variant A-binding protein 1, hJumpy) (MaxLight 750)
MBS6322811-01 0.1 mL

MTMR14, NT (MTMR14, C3orf29, Myotubularin-related protein 14, HCV NS5A-transactivated protein 4 splice variant A-binding protein 1, hJumpy) (MaxLight 750)

Sign In for Pricing
View Details
MTMR14, NT (MTMR14, C3orf29, Myotubularin-related protein 14, HCV NS5A-transactivated protein 4 splice variant A-binding protein 1, hJumpy) (MaxLight 750)
MBS6322811-02 5x 0.1 mL

MTMR14, NT (MTMR14, C3orf29, Myotubularin-related protein 14, HCV NS5A-transactivated protein 4 splice variant A-binding protein 1, hJumpy) (MaxLight 750)

Sign In for Pricing
View Details
IL-9 Rabbit Polyclonal Antibody (BF647)
orb2552266 100 µL

IL-9 Rabbit Polyclonal Antibody (BF647)

Sign In for Pricing
View Details
Research Grade Anti-Human CD269/TNFRSF17/BCMA (SGN-BCMA)
MBS1581471-01 0.1 mg

Research Grade Anti-Human CD269/TNFRSF17/BCMA (SGN-BCMA)

Sign In for Pricing
View Details
Research Grade Anti-Human CD269/TNFRSF17/BCMA (SGN-BCMA)
MBS1581471-02 1 mg

Research Grade Anti-Human CD269/TNFRSF17/BCMA (SGN-BCMA)

Sign In for Pricing
View Details