Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor alpha variable 1-1 (TVA11)

This Recombinant Human T cell receptor alpha variable 1-1 (TVA11) spans the amino acid sequence from region 19-108. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor alpha variable 1-1 TRAV1-1

UniProt

A0A0B4J248

Expression Region

19-108

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QSLEQPSEVTAVEGAIVQINCTYQTSGFYGLSWYQQHDGGAPTFLSYNALDGLEETGRFSSFLSRSDSYGYLLLQELQMKDSASYFCAVR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Hexyl Glyoxylate
TRC-H296500-2.5G 2.5 g

Hexyl Glyoxylate

Sign In for Pricing
View Details
Harm.Ph. Sabouraud Dextrose Agar with Chloramphenicol 10 x 90 mm Petri
TMB_SABC_P90_10 10 x 90 mm Petri

Harm.Ph. Sabouraud Dextrose Agar with Chloramphenicol 10 x 90 mm Petri

Sign In for Pricing
View Details
KBTBD8 Rabbit Polyclonal Antibody (AP)
orb948393 100 µL

KBTBD8 Rabbit Polyclonal Antibody (AP)

Sign In for Pricing
View Details
Brequinar 10mg
A12442-10 10 mg

Brequinar 10mg

Sign In for Pricing
View Details
Gpx4 Protein Vector (Mouse) (pPM-C-His)
PV186457 500 ng

Gpx4 Protein Vector (Mouse) (pPM-C-His)

Sign In for Pricing
View Details
4- (Butan-2-yloxy) -6-chloro-2-methylpyrimidine
ZZB04750-01 100 mg

4- (Butan-2-yloxy) -6-chloro-2-methylpyrimidine

Sign In for Pricing
View Details