Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor alpha variable 5 (TVA5)

This Recombinant Human T cell receptor alpha variable 5 (TVA5) spans the amino acid sequence from region 23-113. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor alpha variable 5 TRAV5

UniProt

A0A0B4J249

Expression Region

23-113

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

EDVEQSLFLSVREGDSSVINCTYTDSSSTYLYWYKQEPGAGLQLLTYIFSNMDMKQDQRLTVLLNKKDKHLSLRIADTQTGDSAIYFCAES

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue FFPE Sections, Endometrium
CS715035 5x 5 µm

Tissue FFPE Sections, Endometrium

Sign In for Pricing
View Details
Human ZNF439 activation kit by CRISPRa
GA114040 1 Kit

Human ZNF439 activation kit by CRISPRa

Sign In for Pricing
View Details
Bromocyclobutane
TRC-B685023-250MG 250 mg

Bromocyclobutane

Sign In for Pricing
View Details
Tissue Protein Lysate, Colon: sigmoid
CP556095 150 µg

Tissue Protein Lysate, Colon: sigmoid

Sign In for Pricing
View Details
High Temperature Circulator BCHT-3301
BCHT-3301 1 Unit

High Temperature Circulator BCHT-3301

Sign In for Pricing
View Details
Amelotin (AMTN) Mouse Monoclonal Antibody [Clone ID: OTI2D9]
CF808526 100 µg

Amelotin (AMTN) Mouse Monoclonal Antibody [Clone ID: OTI2D9]

Sign In for Pricing
View Details