Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor alpha variable 38-1 (TV381)

This Recombinant Human T cell receptor alpha variable 38-1 (TV381) spans the amino acid sequence from region 22-116. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor alpha variable 38-1 TRAV38-1

UniProt

A0A0B4J264

Expression Region

22-116

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QTVTQSQPEMSVQEAETVTLSCTYDTSENNYYLFWYKQPPSRQMILVIRQEAYKQQNATENRFSVNFQKAAKSFSLKISDSQLGDTAMYFCAFMK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Phospho-DAB1 (Y232) Antibody
A42297-50UG 50 µg

Phospho-DAB1 (Y232) Antibody

Sign In for Pricing
View Details
Prostaglandin B1
TN7771-01 10 mg

Prostaglandin B1

Sign In for Pricing
View Details
Prostaglandin B1
TN7771-02 50 mg

Prostaglandin B1

Sign In for Pricing
View Details
Transglutaminase 6 (TGM6) (NM_001254734) Human Tagged ORF Clone
RG233025 10 µg

Transglutaminase 6 (TGM6) (NM_001254734) Human Tagged ORF Clone

Sign In for Pricing
View Details
CYP27B1 (NM_000785) Human Untagged Clone
SC123873 10 µg

CYP27B1 (NM_000785) Human Untagged Clone

Sign In for Pricing
View Details
MLN-0415
MBS5813918 Inquire

MLN-0415

Sign In for Pricing
View Details