Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor alpha variable 38-1 (TV381)

This Recombinant Human T cell receptor alpha variable 38-1 (TV381) spans the amino acid sequence from region 22-116. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor alpha variable 38-1 TRAV38-1

UniProt

A0A0B4J264

Expression Region

22-116

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QTVTQSQPEMSVQEAETVTLSCTYDTSENNYYLFWYKQPPSRQMILVIRQEAYKQQNATENRFSVNFQKAAKSFSLKISDSQLGDTAMYFCAFMK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human Sulfotransferase 2A1/SULT2A1 (N-6His)
CF92-50ug 50 µg

Recombinant Human Sulfotransferase 2A1/SULT2A1 (N-6His)

Sign In for Pricing
View Details
Recombinant Rat Fatty Acid Binding Protein 2, Intestinal (FABP2)
RPU41360-01 50 µg

Recombinant Rat Fatty Acid Binding Protein 2, Intestinal (FABP2)

Sign In for Pricing
View Details
Recombinant Rat Fatty Acid Binding Protein 2, Intestinal (FABP2)
RPU41360-02 100 µg

Recombinant Rat Fatty Acid Binding Protein 2, Intestinal (FABP2)

Sign In for Pricing
View Details
Recombinant Rat Fatty Acid Binding Protein 2, Intestinal (FABP2)
RPU41360-03 1 mg

Recombinant Rat Fatty Acid Binding Protein 2, Intestinal (FABP2)

Sign In for Pricing
View Details
5' ATTO-Rho6G / 3' TAMRA
orb1734480 30 to 49 nmol

5' ATTO-Rho6G / 3' TAMRA

Sign In for Pricing
View Details
Phospho-TrkA/B (Tyr490/Tyr516) Rabbit mAb, 1 pack = 20 µL
BAL1995 1 Each

Phospho-TrkA/B (Tyr490/Tyr516) Rabbit mAb, 1 pack = 20 µL

Sign In for Pricing
View Details