Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor alpha variable 4 (TVA4)

This Recombinant Human T cell receptor alpha variable 4 (TVA4) spans the amino acid sequence from region 20-109. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor alpha variable 4 TRAV4

UniProt

A0A0B4J268

Expression Region

20-109

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

KTTQPISMDSYEGQEVNITCSHNNIATNDYITWYQQFPSQGPRFIIQGYKTKVTNEVASLFIPADRKSSTLSLPRVSLSDTAVYYCLVGD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Brefeldin A
SIH-225-25MG 25 mg

Brefeldin A

Sign In for Pricing
View Details
2-Ethynylpyridine
TRC-E937503-500MG 500 mg

2-Ethynylpyridine

Sign In for Pricing
View Details
Recombinant Human Bruton Tyrosine Kinase/BTK Kinase Protein (His Tag)
PKSH030407 50 µg

Recombinant Human Bruton Tyrosine Kinase/BTK Kinase Protein (His Tag)

Sign In for Pricing
View Details
CD11a (Cris-3), CF647 conjugate, 0.1mg/mL
BNC470151-100 1x 100 µL

CD11a (Cris-3), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Lewis A (7LE), CF647 conjugate, 0.1mg/mL
BNC470311-500 1x 500 µL

Lewis A (7LE), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Glypican 3 (GPC3) (NM_001164618) Human Over-expression Lysate
LY431487 100 µg

Glypican 3 (GPC3) (NM_001164618) Human Over-expression Lysate

Sign In for Pricing
View Details