Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor alpha variable 12-3 (TVAL3)

This Recombinant Human T cell receptor alpha variable 12-3 (TVAL3) spans the amino acid sequence from region 22-114. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor alpha variable 12-3 TRAV12-3

UniProt

A0A0B4J271

Expression Region

22-114

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QQKEVEQDPGPLSVPEGAIVSLNCTYSNSAFQYFMWYRQYSRKGPELLMYTYSSGNKEDGRFTAQVDKSSKYISLFIRDSQPSDSATYLCAMS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ARL6 (ADP-Ribosylation Factor-like Protein 6, Bardet-Biedl Syndrome 3 Protein, ARL6, BBS3) (MaxLight 550)
MBS6454277-01 0.1 mL

ARL6 (ADP-Ribosylation Factor-like Protein 6, Bardet-Biedl Syndrome 3 Protein, ARL6, BBS3) (MaxLight 550)

Sign In for Pricing
View Details
ARL6 (ADP-Ribosylation Factor-like Protein 6, Bardet-Biedl Syndrome 3 Protein, ARL6, BBS3) (MaxLight 550)
MBS6454277-02 5x 0.1 mL

ARL6 (ADP-Ribosylation Factor-like Protein 6, Bardet-Biedl Syndrome 3 Protein, ARL6, BBS3) (MaxLight 550)

Sign In for Pricing
View Details
SAR1AP4 Recombinant Protein (Human)
RP095871 100 µg

SAR1AP4 Recombinant Protein (Human)

Sign In for Pricing
View Details
Matrilin 1 Polyclonal Antibody, AbBy Fluor™ 750 Conjugated
bs-1976R-BF750-01 20 µL

Matrilin 1 Polyclonal Antibody, AbBy Fluor™ 750 Conjugated

Sign In for Pricing
View Details
Matrilin 1 Polyclonal Antibody, AbBy Fluor™ 750 Conjugated
bs-1976R-BF750-02 100 µL

Matrilin 1 Polyclonal Antibody, AbBy Fluor™ 750 Conjugated

Sign In for Pricing
View Details
FAM86B2 3'UTR GFP Stable Cell Line
TU057432 1.0 mL

FAM86B2 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details