Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor alpha variable 24 (TVA24)

This Recombinant Human T cell receptor alpha variable 24 (TVA24) spans the amino acid sequence from region 23-114. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor alpha variable 24 TRAV24

UniProt

A0A0B4J272

Expression Region

23-114

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

ILNVEQSPQSLHVQEGDSTNFTCSFPSSNFYALHWYRWETAKSPEALFVMTLNGDEKKKGRISATLNTKEGYSYLYIKGSQPEDSATYLCAF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GPKOW Protein Lysate (Human) with C-Ha Tag
22469031 100 µg

GPKOW Protein Lysate (Human) with C-Ha Tag

Sign In for Pricing
View Details
Goat Sex Determining Region Y Box Protein 18 ELISA Kit
MBS735323-01 48 Well

Goat Sex Determining Region Y Box Protein 18 ELISA Kit

Sign In for Pricing
View Details
Goat Sex Determining Region Y Box Protein 18 ELISA Kit
MBS735323-02 96 Well

Goat Sex Determining Region Y Box Protein 18 ELISA Kit

Sign In for Pricing
View Details
Goat Sex Determining Region Y Box Protein 18 ELISA Kit
MBS735323-03 5x 96 Well

Goat Sex Determining Region Y Box Protein 18 ELISA Kit

Sign In for Pricing
View Details
Goat Sex Determining Region Y Box Protein 18 ELISA Kit
MBS735323-04 10x 96 Well

Goat Sex Determining Region Y Box Protein 18 ELISA Kit

Sign In for Pricing
View Details
Nanog (Homeobox Protein NANOG, ENK, Embryonic Stem Cell Specific Homeobox Protein, Homeobox Transcription Factor Nanog) (MaxLight 405) discontinued
301411-ML405 100 µL

Nanog (Homeobox Protein NANOG, ENK, Embryonic Stem Cell Specific Homeobox Protein, Homeobox Transcription Factor Nanog) (MaxLight 405) discontinued

Sign In for Pricing
View Details