Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor alpha variable 34 (TVA34)

This Recombinant Human T cell receptor alpha variable 34 (TVA34) spans the amino acid sequence from region 22-112. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor alpha variable 34 TRAV34

UniProt

A0A0B4J273

Expression Region

22-112

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QELEQSPQSLIVQEGKNLTINCTSSKTLYGLYWYKQKYGEGLIFLMMLQKGGEEKSHEKITAKLDEKKQQSSLHITASQPSHAGIYLCGAD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

3-Aminobenzoic Acid
TRC-A591490-10G 10 g

3-Aminobenzoic Acid

Sign In for Pricing
View Details
Human ERCC8 activation kit by CRISPRa
GA100833 1 Kit

Human ERCC8 activation kit by CRISPRa

Sign In for Pricing
View Details
Collagen IV (COL4A3) (NM_000091) Human Recombinant Protein
TP790215 50 µg

Collagen IV (COL4A3) (NM_000091) Human Recombinant Protein

Sign In for Pricing
View Details
CCDC39 (NM_181426) Human Over-expression Lysate
LY430527 100 µg

CCDC39 (NM_181426) Human Over-expression Lysate

Sign In for Pricing
View Details
NIPAL4 (NM_001099287) Human Over-expression Lysate
LY420426 100 µg

NIPAL4 (NM_001099287) Human Over-expression Lysate

Sign In for Pricing
View Details
Dichloroacetaldehyde Hydrate
TRC-D431765-1G 1 g

Dichloroacetaldehyde Hydrate

Sign In for Pricing
View Details