Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor alpha variable 20 (TVA20)

This Recombinant Human T cell receptor alpha variable 20 (TVA20) spans the amino acid sequence from region 22-112. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor alpha variable 20 TRAV20

UniProt

A0A0B4J274

Expression Region

22-112

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

EDQVTQSPEALRLQEGESSSLNCSYTVSGLRGLFWYRQDPGKGPEFLFTLYSAGEEKEKERLKATLTKKESFLHITAPKPEDSATYLCAVQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

(S,S)-(-)-Hydrobenzoin
TRC-H714520-25G 25 g

(S,S)-(-)-Hydrobenzoin

Sign In for Pricing
View Details
Formononetin 7-O-Beta-D-Glucuronide
TRC-F693210-10MG 10 mg

Formononetin 7-O-Beta-D-Glucuronide

Sign In for Pricing
View Details
SYCE3 (NM_001123225) Human Over-expression Lysate
LY426602 100 µg

SYCE3 (NM_001123225) Human Over-expression Lysate

Sign In for Pricing
View Details
Dibromoformaldoxime
TRC-D425300-1G 1 g

Dibromoformaldoxime

Sign In for Pricing
View Details
CD19 (CVID3/155), CF568 conjugate, 0.1mg/mL
BNC680155-500 1x 500 µL

CD19 (CVID3/155), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Occludin (OCLN) (Tight Junctions Marker) (OCLN/2183), CF488A conjugate, 0.1mg/mL
BNC882183-500 1x 500 µL

Occludin (OCLN) (Tight Junctions Marker) (OCLN/2183), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details