Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor alpha variable 17 (TVA17)

This Recombinant Human T cell receptor alpha variable 17 (TVA17) spans the amino acid sequence from region 22-112. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor alpha variable 17 TRAV17

UniProt

A0A0B4J275

Expression Region

22-112

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QQGEEDPQALSIQEGENATMNCSYKTSINNLQWYRQNSGRGLVHLILIRSNEREKHSGRLRVTLDTSKKSSSLLITASRAADTASYFCATD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Colloidal Gold Conjugated Monoclonal Antibody to Herpes Simplex II,  30nm
GM-16-30 1 mL

Colloidal Gold Conjugated Monoclonal Antibody to Herpes Simplex II, 30nm

Sign In for Pricing
View Details
Tmem9b Mouse Gene Knockout Kit (CRISPR)
KN517920 1 Kit

Tmem9b Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Myoglobin (Muscle Cell Marker) (MB/2105), CF740 conjugate, 0.1mg/mL
BNC742105-100 1x 100 µL

Myoglobin (Muscle Cell Marker) (MB/2105), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human C9orf78 activation kit by CRISPRa
GA109978 1 Kit

Human C9orf78 activation kit by CRISPRa

Sign In for Pricing
View Details
C18orf63 Antibody
KC-34794-01 50 μL

C18orf63 Antibody

Sign In for Pricing
View Details
C18orf63 Antibody
KC-34794-02 100 µL

C18orf63 Antibody

Sign In for Pricing
View Details