Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor alpha variable 17 (TVA17)

This Recombinant Human T cell receptor alpha variable 17 (TVA17) spans the amino acid sequence from region 22-112. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor alpha variable 17 TRAV17

UniProt

A0A0B4J275

Expression Region

22-112

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QQGEEDPQALSIQEGENATMNCSYKTSINNLQWYRQNSGRGLVHLILIRSNEREKHSGRLRVTLDTSKKSSSLLITASRAADTASYFCATD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NEK11 (NM_001146003) Human Over-expression Lysate
LY431511 100 µg

NEK11 (NM_001146003) Human Over-expression Lysate

Sign In for Pricing
View Details
Frozen Tissue Blocks, Lung
CB507162 1 Block

Frozen Tissue Blocks, Lung

Sign In for Pricing
View Details
4,5-Disulfo Rhodamine-123 Dicarboxylic Acid Lithium Salt(Mixture of isomers, Technical Grade)
TRC-D678820-5MG 5 mg

4,5-Disulfo Rhodamine-123 Dicarboxylic Acid Lithium Salt(Mixture of isomers, Technical Grade)

Sign In for Pricing
View Details
ILKAP Recombinant Rabbit Monoclonal Antibody [PSH06-85]
HA722759 100 µL

ILKAP Recombinant Rabbit Monoclonal Antibody [PSH06-85]

Sign In for Pricing
View Details
Frozen Tissue Sections, Liver
CS509815 5x 5 µm

Frozen Tissue Sections, Liver

Sign In for Pricing
View Details
Oct6 (POU3F1) (NM_002699) Human Over-expression Lysate
LY419165 100 µg

Oct6 (POU3F1) (NM_002699) Human Over-expression Lysate

Sign In for Pricing
View Details