Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor alpha variable 17 (TVA17)

This Recombinant Human T cell receptor alpha variable 17 (TVA17) spans the amino acid sequence from region 22-112. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor alpha variable 17 TRAV17

UniProt

A0A0B4J275

Expression Region

22-112

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QQGEEDPQALSIQEGENATMNCSYKTSINNLQWYRQNSGRGLVHLILIRSNEREKHSGRLRVTLDTSKKSSSLLITASRAADTASYFCATD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

β-Catenin (D10A8) XP® Rabbit Monoclonal Antibody (Alexa Fluor® 594 Conjugate)
CST 70194S 100 µL

β-Catenin (D10A8) XP® Rabbit Monoclonal Antibody (Alexa Fluor® 594 Conjugate)

Sign In for Pricing
View Details
Rabbit Anti Porcine Whole Serum Polyclonal Antiserum
MBS8421220-01 1 mL

Rabbit Anti Porcine Whole Serum Polyclonal Antiserum

Sign In for Pricing
View Details
Rabbit Anti Porcine Whole Serum Polyclonal Antiserum
MBS8421220-02 5x 1 mL

Rabbit Anti Porcine Whole Serum Polyclonal Antiserum

Sign In for Pricing
View Details
ABAT Recombinant Protein Antigen
NBP1-83401PEP 0.1 mL

ABAT Recombinant Protein Antigen

Sign In for Pricing
View Details
Recombinant Mycobacterium tuberculosis NADH-quinone oxidoreductase subunit K (nuoK), partial
MBS7064682 Inquire

Recombinant Mycobacterium tuberculosis NADH-quinone oxidoreductase subunit K (nuoK), partial

Sign In for Pricing
View Details
Serotonin transporter Antibody [B14A13]
C21090-50uL 50 μL

Serotonin transporter Antibody [B14A13]

Sign In for Pricing
View Details