Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor alpha variable 25 (TVA25)

This Recombinant Human T cell receptor alpha variable 25 (TVA25) spans the amino acid sequence from region 20-109. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor alpha variable 25 TRAV25

UniProt

A0A0B4J276

Expression Region

20-109

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QQVMQIPQYQHVQEGEDFTTYCNSSTTLSNIQWYKQRPGGHPVFLIQLVKSGEVKKQKRLTFQFGEAKKNSSLHITATQTTDVGTYFCAG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RFPL2 Polyclonal Antibody
E-AB-90903-01 60 µL

RFPL2 Polyclonal Antibody

Sign In for Pricing
View Details
RFPL2 Polyclonal Antibody
E-AB-90903-02 120 µL

RFPL2 Polyclonal Antibody

Sign In for Pricing
View Details
RFPL2 Polyclonal Antibody
E-AB-90903-03 200 µL

RFPL2 Polyclonal Antibody

Sign In for Pricing
View Details
Bismuth Subsalicylate
TRC-B497290-50MG 50 mg

Bismuth Subsalicylate

Sign In for Pricing
View Details
2-Chloro-1-(3,4-dihydroxyphenyl)ethanone
TRC-C365325-25G 25 g

2-Chloro-1-(3,4-dihydroxyphenyl)ethanone

Sign In for Pricing
View Details
NF2 (NM_181831) Human Over-expression Lysate
LC430575 20 µg

NF2 (NM_181831) Human Over-expression Lysate

Sign In for Pricing
View Details