Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor alpha variable 25 (TVA25)

This Recombinant Human T cell receptor alpha variable 25 (TVA25) spans the amino acid sequence from region 20-109. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor alpha variable 25 TRAV25

UniProt

A0A0B4J276

Expression Region

20-109

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QQVMQIPQYQHVQEGEDFTTYCNSSTTLSNIQWYKQRPGGHPVFLIQLVKSGEVKKQKRLTFQFGEAKKNSSLHITATQTTDVGTYFCAG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SP17 (SPA17) Mouse Monoclonal Antibody [Clone ID: OTI1D9]
CF804291 100 µg

SP17 (SPA17) Mouse Monoclonal Antibody [Clone ID: OTI1D9]

Sign In for Pricing
View Details
H3FT (HIST3H3) Rabbit Monoclonal Antibody [Clone ID: R06-4I8]
TA384388 100 µL

H3FT (HIST3H3) Rabbit Monoclonal Antibody [Clone ID: R06-4I8]

Sign In for Pricing
View Details
Human KIAA1984 (CCDC183) activation kit by CRISPRa
GA113802 1 Kit

Human KIAA1984 (CCDC183) activation kit by CRISPRa

Sign In for Pricing
View Details
ACBD5 (NM_001042473) Human Over-expression Lysate
LC420927 20 µg

ACBD5 (NM_001042473) Human Over-expression Lysate

Sign In for Pricing
View Details
4'-Hydroxynonanophenone
TRC-H948790-2G 2 g

4'-Hydroxynonanophenone

Sign In for Pricing
View Details
hSET1 (SETD1A) Human Gene Knockout Kit (CRISPR)
KN414996 1 Kit

hSET1 (SETD1A) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details