Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor alpha variable 22 (TVA22)

This Recombinant Human T cell receptor alpha variable 22 (TVA22) spans the amino acid sequence from region 22-110. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor alpha variable 22 TRAV22

UniProt

A0A0B4J277

Expression Region

22-110

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

IQVEQSPPDLILQEGANSTLRCNFSDSVNNLQWFHQNPWGQLINLFYIPSGTKQNGRLSATTVATERYSLLYISSSQTTDSGVYFCAVE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Phosphotyrosine (P-Tyr) (PY265), CF568 conjugate, 0.1mg/mL
BNC680265-100 1x 100 µL

Phosphotyrosine (P-Tyr) (PY265), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
DCLK3 Antibody
8C11659-AAT 50 µg

DCLK3 Antibody

Sign In for Pricing
View Details
Polaprezinc
TRC-P688000-500MG 500 mg

Polaprezinc

Sign In for Pricing
View Details
D-Gluco-Hexodialdose
TRC-G414520-10MG 10 mg

D-Gluco-Hexodialdose

Sign In for Pricing
View Details
CDCA8 Rabbit Polyclonal Antibody
AP11424PU-N 400 µL

CDCA8 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
BAD Human Gene Knockout Kit (CRISPR)
KN200634RB 1 Kit

BAD Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details