Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor alpha variable 22 (TVA22)

This Recombinant Human T cell receptor alpha variable 22 (TVA22) spans the amino acid sequence from region 22-110. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor alpha variable 22 TRAV22

UniProt

A0A0B4J277

Expression Region

22-110

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

IQVEQSPPDLILQEGANSTLRCNFSDSVNNLQWFHQNPWGQLINLFYIPSGTKQNGRLSATTVATERYSLLYISSSQTTDSGVYFCAVE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ethyl 3-(4-Bromo-2-chlorophenyl)-3-oxopropionate
TRC-E196470-500MG 500 mg

Ethyl 3-(4-Bromo-2-chlorophenyl)-3-oxopropionate

Sign In for Pricing
View Details
ATAD3B (NM_031921) Human Recombinant Protein
TP762471 50 µg

ATAD3B (NM_031921) Human Recombinant Protein

Sign In for Pricing
View Details
Tabimorelin
TRC-T003500-5MG 5 mg

Tabimorelin

Sign In for Pricing
View Details
5Alpha-Pregnane-3-one-20Alpha-ol
TRC-P705135-10MG 10 mg

5Alpha-Pregnane-3-one-20Alpha-ol

Sign In for Pricing
View Details
IGFL2 (NM_001002915) Human Over-expression Lysate
LY424111 100 µg

IGFL2 (NM_001002915) Human Over-expression Lysate

Sign In for Pricing
View Details
(1S)-3,4-Dihydro-1-phenyl-2(1H)-isoquinolinecarboxylic Acid 2,5-Dioxo-1-pyrrolidinyl Ester
TRC-D450495-250MG 250 mg

(1S)-3,4-Dihydro-1-phenyl-2(1H)-isoquinolinecarboxylic Acid 2,5-Dioxo-1-pyrrolidinyl Ester

Sign In for Pricing
View Details