Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor alpha variable 22 (TVA22)

This Recombinant Human T cell receptor alpha variable 22 (TVA22) spans the amino acid sequence from region 22-110. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor alpha variable 22 TRAV22

UniProt

A0A0B4J277

Expression Region

22-110

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

IQVEQSPPDLILQEGANSTLRCNFSDSVNNLQWFHQNPWGQLINLFYIPSGTKQNGRLSATTVATERYSLLYISSSQTTDSGVYFCAVE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

JMJD4 (NM_023007) Human Tagged ORF Clone
RG221528 10 µg

JMJD4 (NM_023007) Human Tagged ORF Clone

Sign In for Pricing
View Details
Naalad2 Rat shRNA Plasmid (Locus ID 300384)
TL705375 1 Kit

Naalad2 Rat shRNA Plasmid (Locus ID 300384)

Sign In for Pricing
View Details
ARL3 Polyclonal Antibody, APC-Cy5.5 Conjugated
bs-6162R-APC-Cy5.5 100 µL

ARL3 Polyclonal Antibody, APC-Cy5.5 Conjugated

Sign In for Pricing
View Details
PARP-11 shRNA (h) Lentiviral Particles
sc-76052-V 200 µL

PARP-11 shRNA (h) Lentiviral Particles

Sign In for Pricing
View Details
C9orf100 Protein Vector (Human) (pPB-N-His)
PV006950 500 ng

C9orf100 Protein Vector (Human) (pPB-N-His)

Sign In for Pricing
View Details
NXPH3
402758-01 50 µL

NXPH3

Sign In for Pricing
View Details