Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor alpha variable 21 (TVA21)

This Recombinant Human T cell receptor alpha variable 21 (TVA21) spans the amino acid sequence from region 20-112. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor alpha variable 21 TRAV21

UniProt

A0A0B4J279

Expression Region

20-112

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

KQEVTQIPAALSVPEGENLVLNCSFTDSAIYNLQWFRQDPGKGLTSLLLIQSSQREQTSGRLNASLDKSSGRSTLYIAASQPGDSATYLCAVR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CNGA2 antibody
70R-49567 100 µL

CNGA2 antibody

Sign In for Pricing
View Details
SMURF1 Antibody, HRP conjugated
A68873-50UG 50 µg

SMURF1 Antibody, HRP conjugated

Sign In for Pricing
View Details
PNN Protein Lysate (Rat) with C-HA Tag
37110036 100 µg

PNN Protein Lysate (Rat) with C-HA Tag

Sign In for Pricing
View Details
TRF2 Polyclonal Antibody, Cy5.5 Conjugated
bs-22935R-Cy5.5 100 µL

TRF2 Polyclonal Antibody, Cy5.5 Conjugated

Sign In for Pricing
View Details
NKX6-3 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)
K1432108 1.0 µg DNA

NKX6-3 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
Vitamin D Binding Protein (DBP) Monoclonal Antibody
CAU33855-01 100 µL

Vitamin D Binding Protein (DBP) Monoclonal Antibody

Sign In for Pricing
View Details